Anti DEPDC1B pAb (ATL-HPA072558)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072558-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: DEPDC1B
Alternative Gene Name: BRCC3, XTP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021697: 95%, ENSRNOG00000010701: 93%
Entrez Gene ID: 55789
Uniprot ID: Q8WUY9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IGEVPACRLVHRRQLTEANVEEIWKSMTLSYLQKILGLDSLEEVLDVKLVNSKFIIHNVYSVSKQGVVILDDKSKELPHW |
| Gene Sequence | IGEVPACRLVHRRQLTEANVEEIWKSMTLSYLQKILGLDSLEEVLDVKLVNSKFIIHNVYSVSKQGVVILDDKSKELPHW |
| Gene ID - Mouse | ENSMUSG00000021697 |
| Gene ID - Rat | ENSRNOG00000010701 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DEPDC1B pAb (ATL-HPA072558) | |
| Datasheet | Anti DEPDC1B pAb (ATL-HPA072558) Datasheet (External Link) |
| Vendor Page | Anti DEPDC1B pAb (ATL-HPA072558) at Atlas Antibodies |
| Documents & Links for Anti DEPDC1B pAb (ATL-HPA072558) | |
| Datasheet | Anti DEPDC1B pAb (ATL-HPA072558) Datasheet (External Link) |
| Vendor Page | Anti DEPDC1B pAb (ATL-HPA072558) |
| Citations for Anti DEPDC1B pAb (ATL-HPA072558) – 1 Found |
| Li, Zean; Wang, Qiong; Peng, Shirong; Yao, Kai; Chen, Junxiu; Tao, Yiran; Gao, Ze; Wang, Fen; Li, Hui; Cai, Wenli; Lai, Yiming; Li, Kaiwen; Chen, Xu; Huang, Hai. The metastatic promoter DEPDC1B induces epithelial-mesenchymal transition and promotes prostate cancer cell proliferation via Rac1-PAK1 signaling. Clinical And Translational Medicine. 2020;10(6):e191. PubMed |