Anti DENR pAb (ATL-HPA021783)

Atlas Antibodies

SKU:
ATL-HPA021783-100
  • Immunohistochemical staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus ducts.
  • Immunofluorescent staining of human cell line SiHa shows localization to cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: density-regulated protein
Gene Name: DENR
Alternative Gene Name: DRP, DRP1, SMAP-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023106: 92%, ENSRNOG00000001106: 86%
Entrez Gene ID: 8562
Uniprot ID: O43583
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen AADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKK
Gene Sequence AADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKK
Gene ID - Mouse ENSMUSG00000023106
Gene ID - Rat ENSRNOG00000001106
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DENR pAb (ATL-HPA021783)
Datasheet Anti DENR pAb (ATL-HPA021783) Datasheet (External Link)
Vendor Page Anti DENR pAb (ATL-HPA021783) at Atlas Antibodies

Documents & Links for Anti DENR pAb (ATL-HPA021783)
Datasheet Anti DENR pAb (ATL-HPA021783) Datasheet (External Link)
Vendor Page Anti DENR pAb (ATL-HPA021783)