Anti DENND6B pAb (ATL-HPA029570)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029570-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: DENND6B
Alternative Gene Name: AFI1B, FAM116B, MGC33692
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015377: 96%, ENSRNOG00000029866: 95%
Entrez Gene ID: 414918
Uniprot ID: Q8NEG7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HFDGWYRQRHKEMALKLEALHLEAICEANIETWMKDKSEVEVVDLVLKLREKLVRAQGHQLPVKEATLQRAQLYIETVIGSLPKDLQAVLCPP |
| Gene Sequence | HFDGWYRQRHKEMALKLEALHLEAICEANIETWMKDKSEVEVVDLVLKLREKLVRAQGHQLPVKEATLQRAQLYIETVIGSLPKDLQAVLCPP |
| Gene ID - Mouse | ENSMUSG00000015377 |
| Gene ID - Rat | ENSRNOG00000029866 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DENND6B pAb (ATL-HPA029570) | |
| Datasheet | Anti DENND6B pAb (ATL-HPA029570) Datasheet (External Link) |
| Vendor Page | Anti DENND6B pAb (ATL-HPA029570) at Atlas Antibodies |
| Documents & Links for Anti DENND6B pAb (ATL-HPA029570) | |
| Datasheet | Anti DENND6B pAb (ATL-HPA029570) Datasheet (External Link) |
| Vendor Page | Anti DENND6B pAb (ATL-HPA029570) |