Anti DENND6B pAb (ATL-HPA018934)

Atlas Antibodies

Catalog No.:
ATL-HPA018934-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DENN/MADD domain containing 6B
Gene Name: DENND6B
Alternative Gene Name: AFI1B, FAM116B, MGC33692
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015377: 95%, ENSRNOG00000029866: 92%
Entrez Gene ID: 414918
Uniprot ID: Q8NEG7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HILRVGEPKMSGDLPKQVKLKKPSRLKTLDTKPGLYTAYTAHLHRDKALLKRLLKGVQKKRPSDVQSALLRRHLLELTQ
Gene Sequence HILRVGEPKMSGDLPKQVKLKKPSRLKTLDTKPGLYTAYTAHLHRDKALLKRLLKGVQKKRPSDVQSALLRRHLLELTQ
Gene ID - Mouse ENSMUSG00000015377
Gene ID - Rat ENSRNOG00000029866
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DENND6B pAb (ATL-HPA018934)
Datasheet Anti DENND6B pAb (ATL-HPA018934) Datasheet (External Link)
Vendor Page Anti DENND6B pAb (ATL-HPA018934) at Atlas Antibodies

Documents & Links for Anti DENND6B pAb (ATL-HPA018934)
Datasheet Anti DENND6B pAb (ATL-HPA018934) Datasheet (External Link)
Vendor Page Anti DENND6B pAb (ATL-HPA018934)