Anti DENND6B pAb (ATL-HPA018934)
Atlas Antibodies
- SKU:
- ATL-HPA018934-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DENND6B
Alternative Gene Name: AFI1B, FAM116B, MGC33692
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015377: 95%, ENSRNOG00000029866: 92%
Entrez Gene ID: 414918
Uniprot ID: Q8NEG7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HILRVGEPKMSGDLPKQVKLKKPSRLKTLDTKPGLYTAYTAHLHRDKALLKRLLKGVQKKRPSDVQSALLRRHLLELTQ |
Gene Sequence | HILRVGEPKMSGDLPKQVKLKKPSRLKTLDTKPGLYTAYTAHLHRDKALLKRLLKGVQKKRPSDVQSALLRRHLLELTQ |
Gene ID - Mouse | ENSMUSG00000015377 |
Gene ID - Rat | ENSRNOG00000029866 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DENND6B pAb (ATL-HPA018934) | |
Datasheet | Anti DENND6B pAb (ATL-HPA018934) Datasheet (External Link) |
Vendor Page | Anti DENND6B pAb (ATL-HPA018934) at Atlas Antibodies |
Documents & Links for Anti DENND6B pAb (ATL-HPA018934) | |
Datasheet | Anti DENND6B pAb (ATL-HPA018934) Datasheet (External Link) |
Vendor Page | Anti DENND6B pAb (ATL-HPA018934) |