Anti DENND6A pAb (ATL-HPA062618)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062618-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DENND6A
Alternative Gene Name: AFI1A, FAM116A, FLJ34969
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040818: 92%, ENSRNOG00000011636: 96%
Entrez Gene ID: 201627
Uniprot ID: Q8IWF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ETVDLVLKLKNKLLQADREHLPVKPDTMEKLRTHIDAIILALPEDLQGILL |
| Gene Sequence | ETVDLVLKLKNKLLQADREHLPVKPDTMEKLRTHIDAIILALPEDLQGILL |
| Gene ID - Mouse | ENSMUSG00000040818 |
| Gene ID - Rat | ENSRNOG00000011636 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DENND6A pAb (ATL-HPA062618) | |
| Datasheet | Anti DENND6A pAb (ATL-HPA062618) Datasheet (External Link) |
| Vendor Page | Anti DENND6A pAb (ATL-HPA062618) at Atlas Antibodies |
| Documents & Links for Anti DENND6A pAb (ATL-HPA062618) | |
| Datasheet | Anti DENND6A pAb (ATL-HPA062618) Datasheet (External Link) |
| Vendor Page | Anti DENND6A pAb (ATL-HPA062618) |