Anti DENND6A pAb (ATL-HPA062618)

Atlas Antibodies

Catalog No.: ATL-HPA062618-25

Protein Description: DENN/MADD domain containing 6A
Gene Name: DENND6A
Alternative Gene Name: AFI1A, FAM116A, FLJ34969
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040818: 92%, ENSRNOG00000011636: 96%
Entrez Gene ID: 201627
Uniprot ID: Q8IWF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETVDLVLKLKNKLLQADREHLPVKPDTMEKLRTHIDAIILALPEDLQGILL
• Gene Sequence: ETVDLVLKLKNKLLQADREHLPVKPDTMEKLRTHIDAIILALPEDLQGILL
• Gene ID - Mouse: ENSMUSG00000040818
• Gene ID - Rat: ENSRNOG00000011636
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.