Anti DENND6A pAb (ATL-HPA062618)

Atlas Antibodies

Catalog No.:
ATL-HPA062618-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DENN/MADD domain containing 6A
Gene Name: DENND6A
Alternative Gene Name: AFI1A, FAM116A, FLJ34969
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040818: 92%, ENSRNOG00000011636: 96%
Entrez Gene ID: 201627
Uniprot ID: Q8IWF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETVDLVLKLKNKLLQADREHLPVKPDTMEKLRTHIDAIILALPEDLQGILL
Gene Sequence ETVDLVLKLKNKLLQADREHLPVKPDTMEKLRTHIDAIILALPEDLQGILL
Gene ID - Mouse ENSMUSG00000040818
Gene ID - Rat ENSRNOG00000011636
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DENND6A pAb (ATL-HPA062618)
Datasheet Anti DENND6A pAb (ATL-HPA062618) Datasheet (External Link)
Vendor Page Anti DENND6A pAb (ATL-HPA062618) at Atlas Antibodies

Documents & Links for Anti DENND6A pAb (ATL-HPA062618)
Datasheet Anti DENND6A pAb (ATL-HPA062618) Datasheet (External Link)
Vendor Page Anti DENND6A pAb (ATL-HPA062618)