Anti DENND5B pAb (ATL-HPA038865)

Atlas Antibodies

SKU:
ATL-HPA038865-25
  • Immunohistochemical staining of human testis shows moderate membranous and cytoplasmic positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli & microtubules.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DENN/MADD domain containing 5B
Gene Name: DENND5B
Alternative Gene Name: MGC24039
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030313: 90%, ENSRNOG00000049378: 88%
Entrez Gene ID: 160518
Uniprot ID: Q6ZUT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FIWDFIEKVVAYFETTDQILDNEDDVLIQKSSCKTFCHYVNAINTAPRNIGK
Gene Sequence FIWDFIEKVVAYFETTDQILDNEDDVLIQKSSCKTFCHYVNAINTAPRNIGK
Gene ID - Mouse ENSMUSG00000030313
Gene ID - Rat ENSRNOG00000049378
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DENND5B pAb (ATL-HPA038865)
Datasheet Anti DENND5B pAb (ATL-HPA038865) Datasheet (External Link)
Vendor Page Anti DENND5B pAb (ATL-HPA038865) at Atlas Antibodies

Documents & Links for Anti DENND5B pAb (ATL-HPA038865)
Datasheet Anti DENND5B pAb (ATL-HPA038865) Datasheet (External Link)
Vendor Page Anti DENND5B pAb (ATL-HPA038865)