Anti DENND5B pAb (ATL-HPA038865)
Atlas Antibodies
- SKU:
- ATL-HPA038865-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DENND5B
Alternative Gene Name: MGC24039
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030313: 90%, ENSRNOG00000049378: 88%
Entrez Gene ID: 160518
Uniprot ID: Q6ZUT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FIWDFIEKVVAYFETTDQILDNEDDVLIQKSSCKTFCHYVNAINTAPRNIGK |
Gene Sequence | FIWDFIEKVVAYFETTDQILDNEDDVLIQKSSCKTFCHYVNAINTAPRNIGK |
Gene ID - Mouse | ENSMUSG00000030313 |
Gene ID - Rat | ENSRNOG00000049378 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DENND5B pAb (ATL-HPA038865) | |
Datasheet | Anti DENND5B pAb (ATL-HPA038865) Datasheet (External Link) |
Vendor Page | Anti DENND5B pAb (ATL-HPA038865) at Atlas Antibodies |
Documents & Links for Anti DENND5B pAb (ATL-HPA038865) | |
Datasheet | Anti DENND5B pAb (ATL-HPA038865) Datasheet (External Link) |
Vendor Page | Anti DENND5B pAb (ATL-HPA038865) |