Anti DENND5A pAb (ATL-HPA052923)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052923-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DENND5A
Alternative Gene Name: FLJ22354, FLJ33829, FLJ43455, KIAA1091, RAB6IP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035901: 80%, ENSRNOG00000012206: 80%
Entrez Gene ID: 23258
Uniprot ID: Q6IQ26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MHNAEYDVLHAPPADDRDQSSMEDGEDTPVTKLQR |
| Gene Sequence | MHNAEYDVLHAPPADDRDQSSMEDGEDTPVTKLQR |
| Gene ID - Mouse | ENSMUSG00000035901 |
| Gene ID - Rat | ENSRNOG00000012206 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DENND5A pAb (ATL-HPA052923) | |
| Datasheet | Anti DENND5A pAb (ATL-HPA052923) Datasheet (External Link) |
| Vendor Page | Anti DENND5A pAb (ATL-HPA052923) at Atlas Antibodies |
| Documents & Links for Anti DENND5A pAb (ATL-HPA052923) | |
| Datasheet | Anti DENND5A pAb (ATL-HPA052923) Datasheet (External Link) |
| Vendor Page | Anti DENND5A pAb (ATL-HPA052923) |