Anti DENND5A pAb (ATL-HPA052923)

Atlas Antibodies

Catalog No.:
ATL-HPA052923-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: DENN/MADD domain containing 5A
Gene Name: DENND5A
Alternative Gene Name: FLJ22354, FLJ33829, FLJ43455, KIAA1091, RAB6IP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035901: 80%, ENSRNOG00000012206: 80%
Entrez Gene ID: 23258
Uniprot ID: Q6IQ26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MHNAEYDVLHAPPADDRDQSSMEDGEDTPVTKLQR
Gene Sequence MHNAEYDVLHAPPADDRDQSSMEDGEDTPVTKLQR
Gene ID - Mouse ENSMUSG00000035901
Gene ID - Rat ENSRNOG00000012206
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DENND5A pAb (ATL-HPA052923)
Datasheet Anti DENND5A pAb (ATL-HPA052923) Datasheet (External Link)
Vendor Page Anti DENND5A pAb (ATL-HPA052923) at Atlas Antibodies

Documents & Links for Anti DENND5A pAb (ATL-HPA052923)
Datasheet Anti DENND5A pAb (ATL-HPA052923) Datasheet (External Link)
Vendor Page Anti DENND5A pAb (ATL-HPA052923)