Anti DENND4C pAb (ATL-HPA015096)

Atlas Antibodies

SKU:
ATL-HPA015096-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DENN/MADD domain containing 4C
Gene Name: DENND4C
Alternative Gene Name: bA513M16.3, C9orf55, C9orf55B, FLJ20686
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038024: 90%, ENSRNOG00000008036: 89%
Entrez Gene ID: 55667
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ETNRDYSFPAGLEDHILGENISPNTSISGLVPSELTQSNTSLGSSSSSGDVGKLHYPTGEVPFPRGMKGQDFEKSDHGSSQNTSMSSIYQNCAMEVLMSSCSQCRACGALVYDEEIMA
Gene Sequence ETNRDYSFPAGLEDHILGENISPNTSISGLVPSELTQSNTSLGSSSSSGDVGKLHYPTGEVPFPRGMKGQDFEKSDHGSSQNTSMSSIYQNCAMEVLMSSCSQCRACGALVYDEEIMA
Gene ID - Mouse ENSMUSG00000038024
Gene ID - Rat ENSRNOG00000008036
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DENND4C pAb (ATL-HPA015096)
Datasheet Anti DENND4C pAb (ATL-HPA015096) Datasheet (External Link)
Vendor Page Anti DENND4C pAb (ATL-HPA015096) at Atlas Antibodies

Documents & Links for Anti DENND4C pAb (ATL-HPA015096)
Datasheet Anti DENND4C pAb (ATL-HPA015096) Datasheet (External Link)
Vendor Page Anti DENND4C pAb (ATL-HPA015096)



Citations for Anti DENND4C pAb (ATL-HPA015096) – 1 Found
Sano, Hiroyuki; Peck, Grantley R; Kettenbach, Arminja N; Gerber, Scott A; Lienhard, Gustav E. Insulin-stimulated GLUT4 protein translocation in adipocytes requires the Rab10 guanine nucleotide exchange factor Dennd4C. The Journal Of Biological Chemistry. 2011;286(19):16541-5.  PubMed