Anti DENND4C pAb (ATL-HPA015096)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015096-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DENND4C
Alternative Gene Name: bA513M16.3, C9orf55, C9orf55B, FLJ20686
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038024: 90%, ENSRNOG00000008036: 89%
Entrez Gene ID: 55667
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ETNRDYSFPAGLEDHILGENISPNTSISGLVPSELTQSNTSLGSSSSSGDVGKLHYPTGEVPFPRGMKGQDFEKSDHGSSQNTSMSSIYQNCAMEVLMSSCSQCRACGALVYDEEIMA |
Gene Sequence | ETNRDYSFPAGLEDHILGENISPNTSISGLVPSELTQSNTSLGSSSSSGDVGKLHYPTGEVPFPRGMKGQDFEKSDHGSSQNTSMSSIYQNCAMEVLMSSCSQCRACGALVYDEEIMA |
Gene ID - Mouse | ENSMUSG00000038024 |
Gene ID - Rat | ENSRNOG00000008036 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DENND4C pAb (ATL-HPA015096) | |
Datasheet | Anti DENND4C pAb (ATL-HPA015096) Datasheet (External Link) |
Vendor Page | Anti DENND4C pAb (ATL-HPA015096) at Atlas Antibodies |
Documents & Links for Anti DENND4C pAb (ATL-HPA015096) | |
Datasheet | Anti DENND4C pAb (ATL-HPA015096) Datasheet (External Link) |
Vendor Page | Anti DENND4C pAb (ATL-HPA015096) |
Citations for Anti DENND4C pAb (ATL-HPA015096) – 1 Found |
Sano, Hiroyuki; Peck, Grantley R; Kettenbach, Arminja N; Gerber, Scott A; Lienhard, Gustav E. Insulin-stimulated GLUT4 protein translocation in adipocytes requires the Rab10 guanine nucleotide exchange factor Dennd4C. The Journal Of Biological Chemistry. 2011;286(19):16541-5. PubMed |