Anti DENND4B pAb (ATL-HPA071133)

Atlas Antibodies

Catalog No.:
ATL-HPA071133-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: DENN domain containing 4B
Gene Name: DENND4B
Alternative Gene Name: KIAA0476
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042404: 95%, ENSRNOG00000022373: 93%
Entrez Gene ID: 9909
Uniprot ID: O75064
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSPWLTPDPASVQVRLLWDVLTPDPNSCPPLYVLWRVHSQIPQRVVWPGPVPASLSLALLESVLRHVGLNEVHKAVGLLLETLG
Gene Sequence PSPWLTPDPASVQVRLLWDVLTPDPNSCPPLYVLWRVHSQIPQRVVWPGPVPASLSLALLESVLRHVGLNEVHKAVGLLLETLG
Gene ID - Mouse ENSMUSG00000042404
Gene ID - Rat ENSRNOG00000022373
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DENND4B pAb (ATL-HPA071133)
Datasheet Anti DENND4B pAb (ATL-HPA071133) Datasheet (External Link)
Vendor Page Anti DENND4B pAb (ATL-HPA071133) at Atlas Antibodies

Documents & Links for Anti DENND4B pAb (ATL-HPA071133)
Datasheet Anti DENND4B pAb (ATL-HPA071133) Datasheet (External Link)
Vendor Page Anti DENND4B pAb (ATL-HPA071133)