Anti DENND4B pAb (ATL-HPA071133)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071133-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DENND4B
Alternative Gene Name: KIAA0476
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042404: 95%, ENSRNOG00000022373: 93%
Entrez Gene ID: 9909
Uniprot ID: O75064
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PSPWLTPDPASVQVRLLWDVLTPDPNSCPPLYVLWRVHSQIPQRVVWPGPVPASLSLALLESVLRHVGLNEVHKAVGLLLETLG |
Gene Sequence | PSPWLTPDPASVQVRLLWDVLTPDPNSCPPLYVLWRVHSQIPQRVVWPGPVPASLSLALLESVLRHVGLNEVHKAVGLLLETLG |
Gene ID - Mouse | ENSMUSG00000042404 |
Gene ID - Rat | ENSRNOG00000022373 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DENND4B pAb (ATL-HPA071133) | |
Datasheet | Anti DENND4B pAb (ATL-HPA071133) Datasheet (External Link) |
Vendor Page | Anti DENND4B pAb (ATL-HPA071133) at Atlas Antibodies |
Documents & Links for Anti DENND4B pAb (ATL-HPA071133) | |
Datasheet | Anti DENND4B pAb (ATL-HPA071133) Datasheet (External Link) |
Vendor Page | Anti DENND4B pAb (ATL-HPA071133) |