Anti DENND4A pAb (ATL-HPA065343)

Atlas Antibodies

Catalog No.:
ATL-HPA065343-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: DENN/MADD domain containing 4A
Gene Name: DENND4A
Alternative Gene Name: IRLB, MYCPBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053641: 84%, ENSRNOG00000011739: 82%
Entrez Gene ID: 10260
Uniprot ID: Q7Z401
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDTSALSVQGNFDLNSKSKLQENFCTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSLPATLQGATDSLGL
Gene Sequence LDTSALSVQGNFDLNSKSKLQENFCTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSLPATLQGATDSLGL
Gene ID - Mouse ENSMUSG00000053641
Gene ID - Rat ENSRNOG00000011739
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DENND4A pAb (ATL-HPA065343)
Datasheet Anti DENND4A pAb (ATL-HPA065343) Datasheet (External Link)
Vendor Page Anti DENND4A pAb (ATL-HPA065343) at Atlas Antibodies

Documents & Links for Anti DENND4A pAb (ATL-HPA065343)
Datasheet Anti DENND4A pAb (ATL-HPA065343) Datasheet (External Link)
Vendor Page Anti DENND4A pAb (ATL-HPA065343)