Anti DENND4A pAb (ATL-HPA065343)

Atlas Antibodies

SKU: ATL-HPA065343-25

• 
• 

Protein Description: DENN/MADD domain containing 4A
Gene Name: DENND4A
Alternative Gene Name: IRLB, MYCPBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053641: 84%, ENSRNOG00000011739: 82%
Entrez Gene ID: 10260
Uniprot ID: Q7Z401
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDTSALSVQGNFDLNSKSKLQENFCTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSLPATLQGATDSLGL
• Gene Sequence: LDTSALSVQGNFDLNSKSKLQENFCTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSLPATLQGATDSLGL
• Gene ID - Mouse: ENSMUSG00000053641
• Gene ID - Rat: ENSRNOG00000011739
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.