Anti DENND2D pAb (ATL-HPA043630)

Atlas Antibodies

SKU: ATL-HPA043630-100

• 
• 

Protein Description: DENN/MADD domain containing 2D
Gene Name: DENND2D
Alternative Gene Name: FLJ22457, RP5-1180E21.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027901: 81%, ENSRNOG00000017680: 82%
Entrez Gene ID: 79961
Uniprot ID: Q9H6A0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPQDNSGEALKEPERAQEHSLPNFAGGQHFFEYLLVVSLKKKRSEDDYEPIITYQFPKRENLLRGQQEEEERLLKAI
• Gene Sequence: PPQDNSGEALKEPERAQEHSLPNFAGGQHFFEYLLVVSLKKKRSEDDYEPIITYQFPKRENLLRGQQEEEERLLKAI
• Gene ID - Mouse: ENSMUSG00000027901
• Gene ID - Rat: ENSRNOG00000017680
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.