Anti DENND1C pAb (ATL-HPA042839 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA042839-25
  • Immunohistochemistry analysis in human lymph node and liver tissues using Anti-DENND1C antibody. Corresponding DENND1C RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DENN/MADD domain containing 1C
Gene Name: DENND1C
Alternative Gene Name: FAM31C, FLJ22757
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002668: 61%, ENSRNOG00000046050: 61%
Entrez Gene ID: 79958
Uniprot ID: Q8IV53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLSPEDEGCPWAEEALDSSFLGSGEELDLLSEILDSLSMGAKSAGSLRPSQSLDCCHRGDLDSCFSLPNIPRWQPDDKKL
Gene Sequence PLSPEDEGCPWAEEALDSSFLGSGEELDLLSEILDSLSMGAKSAGSLRPSQSLDCCHRGDLDSCFSLPNIPRWQPDDKKL
Gene ID - Mouse ENSMUSG00000002668
Gene ID - Rat ENSRNOG00000046050
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti DENND1C pAb (ATL-HPA042839 w/enhanced validation)
Datasheet Anti DENND1C pAb (ATL-HPA042839 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DENND1C pAb (ATL-HPA042839 w/enhanced validation)