Anti DENND1B pAb (ATL-HPA042586)

Atlas Antibodies

Catalog No.:
ATL-HPA042586-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DENN/MADD domain containing 1B
Gene Name: DENND1B
Alternative Gene Name: C1orf218, FAM31B, FLJ20054, MGC27044
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056268: 66%, ENSRNOG00000011063: 67%
Entrez Gene ID: 163486
Uniprot ID: Q6P3S1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AFLCGGSGDQAEWNLGQDDSALHGKHLPPSPRKRVSSSGLTDSLFILKEENSNKHLGADNVSDPTSGLDFQLTSPEVSQTD
Gene Sequence AFLCGGSGDQAEWNLGQDDSALHGKHLPPSPRKRVSSSGLTDSLFILKEENSNKHLGADNVSDPTSGLDFQLTSPEVSQTD
Gene ID - Mouse ENSMUSG00000056268
Gene ID - Rat ENSRNOG00000011063
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DENND1B pAb (ATL-HPA042586)
Datasheet Anti DENND1B pAb (ATL-HPA042586) Datasheet (External Link)
Vendor Page Anti DENND1B pAb (ATL-HPA042586) at Atlas Antibodies

Documents & Links for Anti DENND1B pAb (ATL-HPA042586)
Datasheet Anti DENND1B pAb (ATL-HPA042586) Datasheet (External Link)
Vendor Page Anti DENND1B pAb (ATL-HPA042586)