Anti DEK pAb (ATL-HPA057799)

Atlas Antibodies

Catalog No.:
ATL-HPA057799-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: DEK proto-oncogene
Gene Name: DEK
Alternative Gene Name: D6S231E
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021377: 92%, ENSRNOG00000016152: 91%
Entrez Gene ID: 7913
Uniprot ID: P35659
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KFRNAMLKSICEVLDLERSGVNSELVKRILNFLMHPKPSGKPLPKSKKTCSKGSKKERNSSGMARKAKRTKCPEI
Gene Sequence KFRNAMLKSICEVLDLERSGVNSELVKRILNFLMHPKPSGKPLPKSKKTCSKGSKKERNSSGMARKAKRTKCPEI
Gene ID - Mouse ENSMUSG00000021377
Gene ID - Rat ENSRNOG00000016152
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DEK pAb (ATL-HPA057799)
Datasheet Anti DEK pAb (ATL-HPA057799) Datasheet (External Link)
Vendor Page Anti DEK pAb (ATL-HPA057799) at Atlas Antibodies

Documents & Links for Anti DEK pAb (ATL-HPA057799)
Datasheet Anti DEK pAb (ATL-HPA057799) Datasheet (External Link)
Vendor Page Anti DEK pAb (ATL-HPA057799)