Anti DEGS2 pAb (ATL-HPA046644)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046644-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DEGS2
Alternative Gene Name: C14orf66, DES2, FADS8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021263: 87%, ENSRNOG00000011716: 90%
Entrez Gene ID: 123099
Uniprot ID: Q6QHC5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PEYYDHLPQHHSWVKVLWDFVFEDSLGPYARVKRVYRLA |
Gene Sequence | PEYYDHLPQHHSWVKVLWDFVFEDSLGPYARVKRVYRLA |
Gene ID - Mouse | ENSMUSG00000021263 |
Gene ID - Rat | ENSRNOG00000011716 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DEGS2 pAb (ATL-HPA046644) | |
Datasheet | Anti DEGS2 pAb (ATL-HPA046644) Datasheet (External Link) |
Vendor Page | Anti DEGS2 pAb (ATL-HPA046644) at Atlas Antibodies |
Documents & Links for Anti DEGS2 pAb (ATL-HPA046644) | |
Datasheet | Anti DEGS2 pAb (ATL-HPA046644) Datasheet (External Link) |
Vendor Page | Anti DEGS2 pAb (ATL-HPA046644) |