Anti DEGS2 pAb (ATL-HPA046644)

Atlas Antibodies

SKU:
ATL-HPA046644-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: delta(4)-desaturase, sphingolipid 2
Gene Name: DEGS2
Alternative Gene Name: C14orf66, DES2, FADS8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021263: 87%, ENSRNOG00000011716: 90%
Entrez Gene ID: 123099
Uniprot ID: Q6QHC5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PEYYDHLPQHHSWVKVLWDFVFEDSLGPYARVKRVYRLA
Gene Sequence PEYYDHLPQHHSWVKVLWDFVFEDSLGPYARVKRVYRLA
Gene ID - Mouse ENSMUSG00000021263
Gene ID - Rat ENSRNOG00000011716
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DEGS2 pAb (ATL-HPA046644)
Datasheet Anti DEGS2 pAb (ATL-HPA046644) Datasheet (External Link)
Vendor Page Anti DEGS2 pAb (ATL-HPA046644) at Atlas Antibodies

Documents & Links for Anti DEGS2 pAb (ATL-HPA046644)
Datasheet Anti DEGS2 pAb (ATL-HPA046644) Datasheet (External Link)
Vendor Page Anti DEGS2 pAb (ATL-HPA046644)