Anti DEGS1 pAb (ATL-HPA076422)
Atlas Antibodies
- Catalog No.:
- ATL-HPA076422-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DEGS1
Alternative Gene Name: DEGS-1, Des-1, DES1, FADS7, MLD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038633: 83%, ENSRNOG00000003223: 83%
Entrez Gene ID: 8560
Uniprot ID: O15121
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE |
| Gene Sequence | YDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE |
| Gene ID - Mouse | ENSMUSG00000038633 |
| Gene ID - Rat | ENSRNOG00000003223 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DEGS1 pAb (ATL-HPA076422) | |
| Datasheet | Anti DEGS1 pAb (ATL-HPA076422) Datasheet (External Link) |
| Vendor Page | Anti DEGS1 pAb (ATL-HPA076422) at Atlas Antibodies |
| Documents & Links for Anti DEGS1 pAb (ATL-HPA076422) | |
| Datasheet | Anti DEGS1 pAb (ATL-HPA076422) Datasheet (External Link) |
| Vendor Page | Anti DEGS1 pAb (ATL-HPA076422) |