Anti DEGS1 pAb (ATL-HPA076422)

Atlas Antibodies

Catalog No.:
ATL-HPA076422-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: delta(4)-desaturase, sphingolipid 1
Gene Name: DEGS1
Alternative Gene Name: DEGS-1, Des-1, DES1, FADS7, MLD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038633: 83%, ENSRNOG00000003223: 83%
Entrez Gene ID: 8560
Uniprot ID: O15121
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE
Gene Sequence YDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE
Gene ID - Mouse ENSMUSG00000038633
Gene ID - Rat ENSRNOG00000003223
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DEGS1 pAb (ATL-HPA076422)
Datasheet Anti DEGS1 pAb (ATL-HPA076422) Datasheet (External Link)
Vendor Page Anti DEGS1 pAb (ATL-HPA076422) at Atlas Antibodies

Documents & Links for Anti DEGS1 pAb (ATL-HPA076422)
Datasheet Anti DEGS1 pAb (ATL-HPA076422) Datasheet (External Link)
Vendor Page Anti DEGS1 pAb (ATL-HPA076422)