Anti DEFB136 pAb (ATL-HPA068255)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068255-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: DEFB136
Alternative Gene Name: DEFB137
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054763: 47%, ENSRNOG00000038757: 47%
Entrez Gene ID: 613210
Uniprot ID: Q30KP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GMFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAKDP |
| Gene Sequence | GMFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAKDP |
| Gene ID - Mouse | ENSMUSG00000054763 |
| Gene ID - Rat | ENSRNOG00000038757 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DEFB136 pAb (ATL-HPA068255) | |
| Datasheet | Anti DEFB136 pAb (ATL-HPA068255) Datasheet (External Link) |
| Vendor Page | Anti DEFB136 pAb (ATL-HPA068255) at Atlas Antibodies |
| Documents & Links for Anti DEFB136 pAb (ATL-HPA068255) | |
| Datasheet | Anti DEFB136 pAb (ATL-HPA068255) Datasheet (External Link) |
| Vendor Page | Anti DEFB136 pAb (ATL-HPA068255) |