Anti DEFB136 pAb (ATL-HPA068255)

Atlas Antibodies

Catalog No.:
ATL-HPA068255-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: defensin beta 136
Gene Name: DEFB136
Alternative Gene Name: DEFB137
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054763: 47%, ENSRNOG00000038757: 47%
Entrez Gene ID: 613210
Uniprot ID: Q30KP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GMFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAKDP
Gene Sequence GMFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAKDP
Gene ID - Mouse ENSMUSG00000054763
Gene ID - Rat ENSRNOG00000038757
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DEFB136 pAb (ATL-HPA068255)
Datasheet Anti DEFB136 pAb (ATL-HPA068255) Datasheet (External Link)
Vendor Page Anti DEFB136 pAb (ATL-HPA068255) at Atlas Antibodies

Documents & Links for Anti DEFB136 pAb (ATL-HPA068255)
Datasheet Anti DEFB136 pAb (ATL-HPA068255) Datasheet (External Link)
Vendor Page Anti DEFB136 pAb (ATL-HPA068255)