Anti DEFB136 pAb (ATL-HPA068255)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068255-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DEFB136
Alternative Gene Name: DEFB137
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054763: 47%, ENSRNOG00000038757: 47%
Entrez Gene ID: 613210
Uniprot ID: Q30KP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GMFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAKDP |
Gene Sequence | GMFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAKDP |
Gene ID - Mouse | ENSMUSG00000054763 |
Gene ID - Rat | ENSRNOG00000038757 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DEFB136 pAb (ATL-HPA068255) | |
Datasheet | Anti DEFB136 pAb (ATL-HPA068255) Datasheet (External Link) |
Vendor Page | Anti DEFB136 pAb (ATL-HPA068255) at Atlas Antibodies |
Documents & Links for Anti DEFB136 pAb (ATL-HPA068255) | |
Datasheet | Anti DEFB136 pAb (ATL-HPA068255) Datasheet (External Link) |
Vendor Page | Anti DEFB136 pAb (ATL-HPA068255) |