Anti DEFB132 pAb (ATL-HPA046399)

Atlas Antibodies

Catalog No.:
ATL-HPA046399-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: defensin, beta 132
Gene Name: DEFB132
Alternative Gene Name: DEFB32, RP5-1103G7.6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074678: 28%, ENSRNOG00000000563: 28%
Entrez Gene ID: 400830
Uniprot ID: Q7Z7B7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS
Gene Sequence PGYCRTCCHWGETALFMCNASRKCCISYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTS
Gene ID - Mouse ENSMUSG00000074678
Gene ID - Rat ENSRNOG00000000563
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DEFB132 pAb (ATL-HPA046399)
Datasheet Anti DEFB132 pAb (ATL-HPA046399) Datasheet (External Link)
Vendor Page Anti DEFB132 pAb (ATL-HPA046399) at Atlas Antibodies

Documents & Links for Anti DEFB132 pAb (ATL-HPA046399)
Datasheet Anti DEFB132 pAb (ATL-HPA046399) Datasheet (External Link)
Vendor Page Anti DEFB132 pAb (ATL-HPA046399)