Anti DEFB125 pAb (ATL-HPA043095 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA043095-25
  • Immunohistochemical staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and DEFB125 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407046).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: defensin, beta 125
Gene Name: DEFB125
Alternative Gene Name: DEFB-25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079173: 35%, ENSRNOG00000019846: 32%
Entrez Gene ID: 245938
Uniprot ID: Q8N687
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVSMLNDLITFDTTKFGETMTPETNTPETTMPPSEATTPETTMPPSETATSETMPPPSQTALTHN
Gene Sequence PVSMLNDLITFDTTKFGETMTPETNTPETTMPPSEATTPETTMPPSETATSETMPPPSQTALTHN
Gene ID - Mouse ENSMUSG00000079173
Gene ID - Rat ENSRNOG00000019846
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti DEFB125 pAb (ATL-HPA043095 w/enhanced validation)
Datasheet Anti DEFB125 pAb (ATL-HPA043095 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DEFB125 pAb (ATL-HPA043095 w/enhanced validation)