Anti DEFB124 pAb (ATL-HPA051046)

Atlas Antibodies

Catalog No.:
ATL-HPA051046-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: defensin, beta 124
Gene Name: DEFB124
Alternative Gene Name: DEFB-24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074678: 69%, ENSRNOG00000036895: 69%
Entrez Gene ID: 245937
Uniprot ID: Q8NES8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE
Gene Sequence FKRCWKGQGACQTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE
Gene ID - Mouse ENSMUSG00000074678
Gene ID - Rat ENSRNOG00000036895
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DEFB124 pAb (ATL-HPA051046)
Datasheet Anti DEFB124 pAb (ATL-HPA051046) Datasheet (External Link)
Vendor Page Anti DEFB124 pAb (ATL-HPA051046) at Atlas Antibodies

Documents & Links for Anti DEFB124 pAb (ATL-HPA051046)
Datasheet Anti DEFB124 pAb (ATL-HPA051046) Datasheet (External Link)
Vendor Page Anti DEFB124 pAb (ATL-HPA051046)