Anti DEFB119 pAb (ATL-HPA043059)

Atlas Antibodies

SKU: ATL-HPA043059-25

• 

Protein Description: defensin, beta 119
Gene Name: DEFB119
Alternative Gene Name: DEFB-19, DEFB-20, DEFB120
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050645: 67%, ENSRNOG00000036897: 65%
Entrez Gene ID: 245932
Uniprot ID: Q8N690
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP
• Gene Sequence: KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP
• Gene ID - Mouse: ENSMUSG00000050645
• Gene ID - Rat: ENSRNOG00000036897
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DEFB119 pAb (ATL-HPA043059) – 1 Found

Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88.