Anti DEFB119 pAb (ATL-HPA043059)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043059-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: DEFB119
Alternative Gene Name: DEFB-19, DEFB-20, DEFB120
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050645: 67%, ENSRNOG00000036897: 65%
Entrez Gene ID: 245932
Uniprot ID: Q8N690
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP |
| Gene Sequence | KRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEENTDWSYEKQWPRLP |
| Gene ID - Mouse | ENSMUSG00000050645 |
| Gene ID - Rat | ENSRNOG00000036897 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DEFB119 pAb (ATL-HPA043059) | |
| Datasheet | Anti DEFB119 pAb (ATL-HPA043059) Datasheet (External Link) |
| Vendor Page | Anti DEFB119 pAb (ATL-HPA043059) at Atlas Antibodies |
| Documents & Links for Anti DEFB119 pAb (ATL-HPA043059) | |
| Datasheet | Anti DEFB119 pAb (ATL-HPA043059) Datasheet (External Link) |
| Vendor Page | Anti DEFB119 pAb (ATL-HPA043059) |
| Citations for Anti DEFB119 pAb (ATL-HPA043059) – 1 Found |
| Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88. PubMed |