Anti DEFB116 pAb (ATL-HPA047430)

Atlas Antibodies

Catalog No.:
ATL-HPA047430-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: defensin, beta 116
Gene Name: DEFB116
Alternative Gene Name: DEFB-16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044249: 44%, ENSRNOG00000023195: 47%
Entrez Gene ID: 245930
Uniprot ID: Q30KQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SHNGKSREPWNPCELYQGMCRNACREYEIQYLTCPNDQKCCLKLSVKITSSKNVKEDYDSNSNLSVTNSSSY
Gene Sequence SHNGKSREPWNPCELYQGMCRNACREYEIQYLTCPNDQKCCLKLSVKITSSKNVKEDYDSNSNLSVTNSSSY
Gene ID - Mouse ENSMUSG00000044249
Gene ID - Rat ENSRNOG00000023195
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DEFB116 pAb (ATL-HPA047430)
Datasheet Anti DEFB116 pAb (ATL-HPA047430) Datasheet (External Link)
Vendor Page Anti DEFB116 pAb (ATL-HPA047430) at Atlas Antibodies

Documents & Links for Anti DEFB116 pAb (ATL-HPA047430)
Datasheet Anti DEFB116 pAb (ATL-HPA047430) Datasheet (External Link)
Vendor Page Anti DEFB116 pAb (ATL-HPA047430)