Anti DEFB115 pAb (ATL-HPA053160)

Atlas Antibodies

Catalog No.:
ATL-HPA053160-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: defensin, beta 115
Gene Name: DEFB115
Alternative Gene Name: DEFB-15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074679: 42%, ENSRNOG00000036900: 44%
Entrez Gene ID: 245929
Uniprot ID: Q30KQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WIRRCYYGTGRCRKSCKEIERKKEKCGEKHICCVPKEKDKLSHIHDQKETSELYI
Gene Sequence WIRRCYYGTGRCRKSCKEIERKKEKCGEKHICCVPKEKDKLSHIHDQKETSELYI
Gene ID - Mouse ENSMUSG00000074679
Gene ID - Rat ENSRNOG00000036900
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DEFB115 pAb (ATL-HPA053160)
Datasheet Anti DEFB115 pAb (ATL-HPA053160) Datasheet (External Link)
Vendor Page Anti DEFB115 pAb (ATL-HPA053160) at Atlas Antibodies

Documents & Links for Anti DEFB115 pAb (ATL-HPA053160)
Datasheet Anti DEFB115 pAb (ATL-HPA053160) Datasheet (External Link)
Vendor Page Anti DEFB115 pAb (ATL-HPA053160)