Anti DEFB108B pAb (ATL-HPA042588)

Atlas Antibodies

SKU:
ATL-HPA042588-25
  • Immunohistochemical staining of human oral mucosa shows strong cytoplasmic positivity in superficial squamous epithelial cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: defensin, beta 108B
Gene Name: DEFB108B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033871: 32%, ENSRNOG00000017503: 34%
Entrez Gene ID: 245911
Uniprot ID: Q8NET1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLGHQPRIESTTP
Gene Sequence GKFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLGHQPRIESTTP
Gene ID - Mouse ENSMUSG00000033871
Gene ID - Rat ENSRNOG00000017503
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DEFB108B pAb (ATL-HPA042588)
Datasheet Anti DEFB108B pAb (ATL-HPA042588) Datasheet (External Link)
Vendor Page Anti DEFB108B pAb (ATL-HPA042588) at Atlas Antibodies

Documents & Links for Anti DEFB108B pAb (ATL-HPA042588)
Datasheet Anti DEFB108B pAb (ATL-HPA042588) Datasheet (External Link)
Vendor Page Anti DEFB108B pAb (ATL-HPA042588)