Anti DEFB108B pAb (ATL-HPA042588)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042588-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DEFB108B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033871: 32%, ENSRNOG00000017503: 34%
Entrez Gene ID: 245911
Uniprot ID: Q8NET1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GKFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLGHQPRIESTTP |
| Gene Sequence | GKFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLGHQPRIESTTP |
| Gene ID - Mouse | ENSMUSG00000033871 |
| Gene ID - Rat | ENSRNOG00000017503 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DEFB108B pAb (ATL-HPA042588) | |
| Datasheet | Anti DEFB108B pAb (ATL-HPA042588) Datasheet (External Link) |
| Vendor Page | Anti DEFB108B pAb (ATL-HPA042588) at Atlas Antibodies |
| Documents & Links for Anti DEFB108B pAb (ATL-HPA042588) | |
| Datasheet | Anti DEFB108B pAb (ATL-HPA042588) Datasheet (External Link) |
| Vendor Page | Anti DEFB108B pAb (ATL-HPA042588) |