Anti DEFB104A pAb (ATL-HPA045292)

Atlas Antibodies

Catalog No.: ATL-HPA045292-25

Protein Description: defensin, beta 104A
Gene Name: DEFB104A
Alternative Gene Name: DEFB-4, DEFB104, DEFB4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074679: 33%, ENSRNOG00000036900: 33%
Entrez Gene ID: 140596
Uniprot ID: Q8WTQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRT
• Gene Sequence: EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRT
• Gene ID - Mouse: ENSMUSG00000074679
• Gene ID - Rat: ENSRNOG00000036900
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.