Anti DEFB104A pAb (ATL-HPA045292)

Atlas Antibodies

Catalog No.:
ATL-HPA045292-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: defensin, beta 104A
Gene Name: DEFB104A
Alternative Gene Name: DEFB-4, DEFB104, DEFB4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074679: 33%, ENSRNOG00000036900: 33%
Entrez Gene ID: 140596
Uniprot ID: Q8WTQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRT
Gene Sequence EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRT
Gene ID - Mouse ENSMUSG00000074679
Gene ID - Rat ENSRNOG00000036900
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DEFB104A pAb (ATL-HPA045292)
Datasheet Anti DEFB104A pAb (ATL-HPA045292) Datasheet (External Link)
Vendor Page Anti DEFB104A pAb (ATL-HPA045292) at Atlas Antibodies

Documents & Links for Anti DEFB104A pAb (ATL-HPA045292)
Datasheet Anti DEFB104A pAb (ATL-HPA045292) Datasheet (External Link)
Vendor Page Anti DEFB104A pAb (ATL-HPA045292)