Anti DEFA6 pAb (ATL-HPA019462 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA019462-100
  • Immunohistochemistry analysis in human small intestine and cerebral cortex tissues using HPA019462 antibody. Corresponding DEFA6 RNA-seq data are presented for the same tissues.
  • Western blot analysis in human small intestine tissue.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: defensin, alpha 6, Paneth cell-specific
Gene Name: DEFA6
Alternative Gene Name: DEF6, HD-6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000082211: 35%, ENSRNOG00000061751: 35%
Entrez Gene ID: 1671
Uniprot ID: Q01524
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFC
Gene Sequence PLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFC
Gene ID - Mouse ENSMUSG00000082211
Gene ID - Rat ENSRNOG00000061751
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DEFA6 pAb (ATL-HPA019462 w/enhanced validation)
Datasheet Anti DEFA6 pAb (ATL-HPA019462 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DEFA6 pAb (ATL-HPA019462 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DEFA6 pAb (ATL-HPA019462 w/enhanced validation)
Datasheet Anti DEFA6 pAb (ATL-HPA019462 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DEFA6 pAb (ATL-HPA019462 w/enhanced validation)



Citations for Anti DEFA6 pAb (ATL-HPA019462 w/enhanced validation) – 7 Found
Uchida, Hajime; Machida, Masakazu; Miura, Takumi; Kawasaki, Tomoyuki; Okazaki, Takuya; Sasaki, Kengo; Sakamoto, Seisuke; Ohuchi, Noriaki; Kasahara, Mureo; Umezawa, Akihiro; Akutsu, Hidenori. A xenogeneic-free system generating functional human gut organoids from pluripotent stem cells. Jci Insight. 2017;2(1):e86492.  PubMed
Granlund, Atle van Beelen; Beisvag, Vidar; Torp, Sverre H; Flatberg, Arnar; Kleveland, Per Martin; Ostvik, Ann Elisabeth; Waldum, Helge L; Sandvik, Arne K. Activation of REG family proteins in colitis. Scandinavian Journal Of Gastroenterology. 2011;46(11):1316-23.  PubMed
van Beelen Granlund, Atle; Østvik, Ann Elisabet; Brenna, Øystein; Torp, Sverre H; Gustafsson, Bjørn I; Sandvik, Arne Kristian. REG gene expression in inflamed and healthy colon mucosa explored by in situ hybridisation. Cell And Tissue Research. 2013;352(3):639-46.  PubMed
Lucero, Carissa M; Fallert Junecko, Beth; Klamar, Cynthia R; Sciullo, Lauren A; Berendam, Stella J; Cillo, Anthony R; Qin, Shulin; Sui, Yongjun; Sanghavi, Sonali; Murphey-Corb, Michael A; Reinhart, Todd A. Macaque paneth cells express lymphoid chemokine CXCL13 and other antimicrobial peptides not previously described as expressed in intestinal crypts. Clinical And Vaccine Immunology : Cvi. 2013;20(8):1320-8.  PubMed
Thorsvik, Silje; Bakke, Ingunn; van Beelen Granlund, Atle; Røyset, Elin Synnøve; Damås, Jan Kristian; Østvik, Ann Elisabet; Sandvik, Arne Kristian. Expression of neutrophil gelatinase-associated lipocalin (NGAL) in the gut in Crohn's disease. Cell And Tissue Research. 2018;374(2):339-348.  PubMed
Katsukura, Nobuhiro; Watanabe, Sho; Shirasaki, Tomoaki; Hibiya, Shuji; Kano, Yoshihito; Akahoshi, Keiichi; Tanabe, Minoru; Kirimura, Susumu; Akashi, Takumi; Kitagawa, Masanobu; Okamoto, Ryuichi; Watanabe, Mamoru; Tsuchiya, Kiichiro. Intestinal phenotype is maintained by Atoh1 in the cancer region of intraductal papillary mucinous neoplasm. Cancer Science. 2021;112(2):932-944.  PubMed
Tsuruta, Satoru; Kawasaki, Tomoyuki; Machida, Masakazu; Iwatsuki, Ken; Inaba, Akihiko; Shibata, Shinsuke; Shindo, Tomoko; Nakabayashi, Kazuhiko; Hakamada, Kenichi; Umezawa, Akihiro; Akutsu, Hidenori. Development of Human Gut Organoids With Resident Tissue Macrophages as a Model of Intestinal Immune Responses. Cellular And Molecular Gastroenterology And Hepatology. 14(3):726-729.e5.  PubMed