Anti DEFA5 pAb (ATL-HPA015775 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA015775-25

• 
• 

Protein Description: defensin, alpha 5, Paneth cell-specific
Gene Name: DEFA5
Alternative Gene Name: DEF5, HD-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094362: 39%, ENSRNOG00000030093: 49%
Entrez Gene ID: 1670
Uniprot ID: Q01523
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR
• Gene Sequence: ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR
• Gene ID - Mouse: ENSMUSG00000094362
• Gene ID - Rat: ENSRNOG00000030093
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DEFA5 pAb (ATL-HPA015775 w/enhanced validation) – 2 Found

Lee, Hyuk-Joon; Nam, Ki Taek; Park, Heae Surng; Kim, Min A; Lafleur, Bonnie J; Aburatani, Hiroyuki; Yang, Han-Kwang; Kim, Woo Ho; Goldenring, James R. Gene expression profiling of metaplastic lineages identifies CDH17 as a prognostic marker in early stage gastric cancer. Gastroenterology. 2010;139(1):213-25.e3. 

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.