Anti DEFA4 pAb (ATL-HPA051266 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA051266-25
  • Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using HPA051266 antibody. Corresponding DEFA4 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: defensin, alpha 4, corticostatin
Gene Name: DEFA4
Alternative Gene Name: DEF4, HP-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074446: 32%, ENSRNOG00000028707: 36%
Entrez Gene ID: 1669
Uniprot ID: P12838
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSALQVSGSTRGMVCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRVD
Gene Sequence SSALQVSGSTRGMVCSCRLVFCRRTELRVGNCLIGGVSFTYCCTRVD
Gene ID - Mouse ENSMUSG00000074446
Gene ID - Rat ENSRNOG00000028707
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DEFA4 pAb (ATL-HPA051266 w/enhanced validation)
Datasheet Anti DEFA4 pAb (ATL-HPA051266 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DEFA4 pAb (ATL-HPA051266 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DEFA4 pAb (ATL-HPA051266 w/enhanced validation)
Datasheet Anti DEFA4 pAb (ATL-HPA051266 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DEFA4 pAb (ATL-HPA051266 w/enhanced validation)



Citations for Anti DEFA4 pAb (ATL-HPA051266 w/enhanced validation) – 1 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed