Anti DEF6 pAb (ATL-HPA038975)
Atlas Antibodies
- SKU:
- ATL-HPA038975-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DEF6
Alternative Gene Name: IBP, SLAT, SWAP70L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002257: 94%, ENSRNOG00000000502: 94%
Entrez Gene ID: 50619
Uniprot ID: Q9H4E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSE |
Gene Sequence | VSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSE |
Gene ID - Mouse | ENSMUSG00000002257 |
Gene ID - Rat | ENSRNOG00000000502 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DEF6 pAb (ATL-HPA038975) | |
Datasheet | Anti DEF6 pAb (ATL-HPA038975) Datasheet (External Link) |
Vendor Page | Anti DEF6 pAb (ATL-HPA038975) at Atlas Antibodies |
Documents & Links for Anti DEF6 pAb (ATL-HPA038975) | |
Datasheet | Anti DEF6 pAb (ATL-HPA038975) Datasheet (External Link) |
Vendor Page | Anti DEF6 pAb (ATL-HPA038975) |