Anti DEF6 pAb (ATL-HPA038975)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038975-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: DEF6
Alternative Gene Name: IBP, SLAT, SWAP70L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002257: 94%, ENSRNOG00000000502: 94%
Entrez Gene ID: 50619
Uniprot ID: Q9H4E7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSE |
| Gene Sequence | VSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSE |
| Gene ID - Mouse | ENSMUSG00000002257 |
| Gene ID - Rat | ENSRNOG00000000502 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DEF6 pAb (ATL-HPA038975) | |
| Datasheet | Anti DEF6 pAb (ATL-HPA038975) Datasheet (External Link) |
| Vendor Page | Anti DEF6 pAb (ATL-HPA038975) at Atlas Antibodies |
| Documents & Links for Anti DEF6 pAb (ATL-HPA038975) | |
| Datasheet | Anti DEF6 pAb (ATL-HPA038975) Datasheet (External Link) |
| Vendor Page | Anti DEF6 pAb (ATL-HPA038975) |