Anti DEDD pAb (ATL-HPA073628)

Atlas Antibodies

Catalog No.:
ATL-HPA073628-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: death effector domain containing
Gene Name: DEDD
Alternative Gene Name: CASP8IP1, DEDD1, DEFT, FLDED1, KE05
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013973: 98%, ENSRNOG00000003779: 98%
Entrez Gene ID: 9191
Uniprot ID: O75618
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEETSIRYVTPRALSD
Gene Sequence LALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEETSIRYVTPRALSD
Gene ID - Mouse ENSMUSG00000013973
Gene ID - Rat ENSRNOG00000003779
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DEDD pAb (ATL-HPA073628)
Datasheet Anti DEDD pAb (ATL-HPA073628) Datasheet (External Link)
Vendor Page Anti DEDD pAb (ATL-HPA073628) at Atlas Antibodies

Documents & Links for Anti DEDD pAb (ATL-HPA073628)
Datasheet Anti DEDD pAb (ATL-HPA073628) Datasheet (External Link)
Vendor Page Anti DEDD pAb (ATL-HPA073628)