Anti DECR1 pAb (ATL-HPA023238 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023238-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: DECR1
Alternative Gene Name: DECR, SDR18C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028223: 85%, ENSRNOG00000008236: 83%
Entrez Gene ID: 1666
Uniprot ID: Q16698
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKT |
| Gene Sequence | MDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKT |
| Gene ID - Mouse | ENSMUSG00000028223 |
| Gene ID - Rat | ENSRNOG00000008236 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DECR1 pAb (ATL-HPA023238 w/enhanced validation) | |
| Datasheet | Anti DECR1 pAb (ATL-HPA023238 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DECR1 pAb (ATL-HPA023238 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti DECR1 pAb (ATL-HPA023238 w/enhanced validation) | |
| Datasheet | Anti DECR1 pAb (ATL-HPA023238 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti DECR1 pAb (ATL-HPA023238 w/enhanced validation) |
| Citations for Anti DECR1 pAb (ATL-HPA023238 w/enhanced validation) – 2 Found |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |
| Nassar, Zeyad D; Mah, Chui Yan; Dehairs, Jonas; Burvenich, Ingrid Jg; Irani, Swati; Centenera, Margaret M; Helm, Madison; Shrestha, Raj K; Moldovan, Max; Don, Anthony S; Holst, Jeff; Scott, Andrew M; Horvath, Lisa G; Lynn, David J; Selth, Luke A; Hoy, Andrew J; Swinnen, Johannes V; Butler, Lisa M. Human DECR1 is an androgen-repressed survival factor that regulates PUFA oxidation to protect prostate tumor cells from ferroptosis. Elife. 2020;9( 32686647) PubMed |