Anti DECR1 pAb (ATL-HPA023238 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA023238-100

• 
• 

Protein Description: 2,4-dienoyl CoA reductase 1, mitochondrial
Gene Name: DECR1
Alternative Gene Name: DECR, SDR18C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028223: 85%, ENSRNOG00000008236: 83%
Entrez Gene ID: 1666
Uniprot ID: Q16698
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKT
• Gene Sequence: MDVLKATAEQISSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKT
• Gene ID - Mouse: ENSMUSG00000028223
• Gene ID - Rat: ENSRNOG00000008236
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DECR1 pAb (ATL-HPA023238 w/enhanced validation) – 2 Found

Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. 

Nassar, Zeyad D; Mah, Chui Yan; Dehairs, Jonas; Burvenich, Ingrid Jg; Irani, Swati; Centenera, Margaret M; Helm, Madison; Shrestha, Raj K; Moldovan, Max; Don, Anthony S; Holst, Jeff; Scott, Andrew M; Horvath, Lisa G; Lynn, David J; Selth, Luke A; Hoy, Andrew J; Swinnen, Johannes V; Butler, Lisa M. Human DECR1 is an androgen-repressed survival factor that regulates PUFA oxidation to protect prostate tumor cells from ferroptosis. Elife. 2020;9( 32686647)