Anti DECR1 pAb (ATL-HPA023162 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA023162-25

• 
• 
• 

Protein Description: 2,4-dienoyl CoA reductase 1, mitochondrial
Gene Name: DECR1
Alternative Gene Name: DECR, SDR18C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028223: 84%, ENSRNOG00000008236: 84%
Entrez Gene ID: 1666
Uniprot ID: Q16698
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKT
• Gene Sequence: TFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKT
• Gene ID - Mouse: ENSMUSG00000028223
• Gene ID - Rat: ENSRNOG00000008236
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.