Anti DEAF1 pAb (ATL-HPA030302)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030302-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: DEAF1
Alternative Gene Name: NUDR, SPN, ZMYND5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058886: 99%, ENSRNOG00000017960: 99%
Entrez Gene ID: 10522
Uniprot ID: O75398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSGGRGRCIKQGENWYSPTE |
Gene Sequence | LIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSGGRGRCIKQGENWYSPTE |
Gene ID - Mouse | ENSMUSG00000058886 |
Gene ID - Rat | ENSRNOG00000017960 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DEAF1 pAb (ATL-HPA030302) | |
Datasheet | Anti DEAF1 pAb (ATL-HPA030302) Datasheet (External Link) |
Vendor Page | Anti DEAF1 pAb (ATL-HPA030302) at Atlas Antibodies |
Documents & Links for Anti DEAF1 pAb (ATL-HPA030302) | |
Datasheet | Anti DEAF1 pAb (ATL-HPA030302) Datasheet (External Link) |
Vendor Page | Anti DEAF1 pAb (ATL-HPA030302) |