Anti DEAF1 pAb (ATL-HPA030302)

Atlas Antibodies

SKU:
ATL-HPA030302-100
  • Immunohistochemical staining of human stomach, lower shows strong cytoplasmic and nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & nucleoli.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Liver tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: DEAF1 transcription factor
Gene Name: DEAF1
Alternative Gene Name: NUDR, SPN, ZMYND5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058886: 99%, ENSRNOG00000017960: 99%
Entrez Gene ID: 10522
Uniprot ID: O75398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSGGRGRCIKQGENWYSPTE
Gene Sequence LIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSGGRGRCIKQGENWYSPTE
Gene ID - Mouse ENSMUSG00000058886
Gene ID - Rat ENSRNOG00000017960
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DEAF1 pAb (ATL-HPA030302)
Datasheet Anti DEAF1 pAb (ATL-HPA030302) Datasheet (External Link)
Vendor Page Anti DEAF1 pAb (ATL-HPA030302) at Atlas Antibodies

Documents & Links for Anti DEAF1 pAb (ATL-HPA030302)
Datasheet Anti DEAF1 pAb (ATL-HPA030302) Datasheet (External Link)
Vendor Page Anti DEAF1 pAb (ATL-HPA030302)