Anti DDX60 pAb (ATL-HPA046952)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046952-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: DDX60
Alternative Gene Name: FLJ20035
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037921: 67%, ENSRNOG00000059097: 73%
Entrez Gene ID: 55601
Uniprot ID: Q8IY21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQSLIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRV |
| Gene Sequence | PKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQSLIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRV |
| Gene ID - Mouse | ENSMUSG00000037921 |
| Gene ID - Rat | ENSRNOG00000059097 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DDX60 pAb (ATL-HPA046952) | |
| Datasheet | Anti DDX60 pAb (ATL-HPA046952) Datasheet (External Link) |
| Vendor Page | Anti DDX60 pAb (ATL-HPA046952) at Atlas Antibodies |
| Documents & Links for Anti DDX60 pAb (ATL-HPA046952) | |
| Datasheet | Anti DDX60 pAb (ATL-HPA046952) Datasheet (External Link) |
| Vendor Page | Anti DDX60 pAb (ATL-HPA046952) |
| Citations for Anti DDX60 pAb (ATL-HPA046952) – 1 Found |
| Geng, Nina; Hu, Tuo; He, Chunbo. Identification of DDX60 as a Regulator of MHC-I Class Molecules in Colorectal Cancer. Biomedicines. 2022;10(12) PubMed |