Anti DDX6 pAb (ATL-HPA024201 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA024201-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box helicase 6
Gene Name: DDX6
Alternative Gene Name: HLR2, RCK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032097: 91%, ENSRNOG00000053932: 93%
Entrez Gene ID: 1656
Uniprot ID: P26196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQSMTTTIKPGDDWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ
Gene Sequence ENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQSMTTTIKPGDDWKKTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ
Gene ID - Mouse ENSMUSG00000032097
Gene ID - Rat ENSRNOG00000053932
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DDX6 pAb (ATL-HPA024201 w/enhanced validation)
Datasheet Anti DDX6 pAb (ATL-HPA024201 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DDX6 pAb (ATL-HPA024201 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DDX6 pAb (ATL-HPA024201 w/enhanced validation)
Datasheet Anti DDX6 pAb (ATL-HPA024201 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DDX6 pAb (ATL-HPA024201 w/enhanced validation)
Citations for Anti DDX6 pAb (ATL-HPA024201 w/enhanced validation) – 1 Found
Guo, Jingtao; Grow, Edward J; Yi, Chongil; Mlcochova, Hana; Maher, Geoffrey J; Lindskog, Cecilia; Murphy, Patrick J; Wike, Candice L; Carrell, Douglas T; Goriely, Anne; Hotaling, James M; Cairns, Bradley R. Chromatin and Single-Cell RNA-Seq Profiling Reveal Dynamic Signaling and Metabolic Transitions during Human Spermatogonial Stem Cell Development. Cell Stem Cell. 2017;21(4):533-546.e6.  PubMed