Anti DDX56 pAb (ATL-HPA019749)

Atlas Antibodies

Catalog No.:
ATL-HPA019749-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box helicase 56
Gene Name: DDX56
Alternative Gene Name: NOH61
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004393: 92%, ENSRNOG00000004670: 93%
Entrez Gene ID: 54606
Uniprot ID: Q9NY93
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen TGPVVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVRVANVSAAEDSVSQRAVLMEKPDVVVGTPSRILSHLQQDSLKLRDS
Gene Sequence TGPVVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVRVANVSAAEDSVSQRAVLMEKPDVVVGTPSRILSHLQQDSLKLRDS
Gene ID - Mouse ENSMUSG00000004393
Gene ID - Rat ENSRNOG00000004670
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DDX56 pAb (ATL-HPA019749)
Datasheet Anti DDX56 pAb (ATL-HPA019749) Datasheet (External Link)
Vendor Page Anti DDX56 pAb (ATL-HPA019749) at Atlas Antibodies

Documents & Links for Anti DDX56 pAb (ATL-HPA019749)
Datasheet Anti DDX56 pAb (ATL-HPA019749) Datasheet (External Link)
Vendor Page Anti DDX56 pAb (ATL-HPA019749)