Anti DDX56 pAb (ATL-HPA019749)

Atlas Antibodies

Catalog No.: ATL-HPA019749-100

Protein Description: DEAD (Asp-Glu-Ala-Asp) box helicase 56
Gene Name: DDX56
Alternative Gene Name: NOH61
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004393: 92%, ENSRNOG00000004670: 93%
Entrez Gene ID: 54606
Uniprot ID: Q9NY93
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TGPVVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVRVANVSAAEDSVSQRAVLMEKPDVVVGTPSRILSHLQQDSLKLRDS
• Gene Sequence: TGPVVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVRVANVSAAEDSVSQRAVLMEKPDVVVGTPSRILSHLQQDSLKLRDS
• Gene ID - Mouse: ENSMUSG00000004393
• Gene ID - Rat: ENSRNOG00000004670
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.