Anti DDX55 pAb (ATL-HPA039962)

Atlas Antibodies

Catalog No.:
ATL-HPA039962-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 55
Gene Name: DDX55
Alternative Gene Name: KIAA1595
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029389: 89%, ENSRNOG00000001043: 90%
Entrez Gene ID: 57696
Uniprot ID: Q8NHQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FALLRMPKMPELRGKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIKNKAWSKQKAK
Gene Sequence FALLRMPKMPELRGKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIKNKAWSKQKAK
Gene ID - Mouse ENSMUSG00000029389
Gene ID - Rat ENSRNOG00000001043
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DDX55 pAb (ATL-HPA039962)
Datasheet Anti DDX55 pAb (ATL-HPA039962) Datasheet (External Link)
Vendor Page Anti DDX55 pAb (ATL-HPA039962) at Atlas Antibodies

Documents & Links for Anti DDX55 pAb (ATL-HPA039962)
Datasheet Anti DDX55 pAb (ATL-HPA039962) Datasheet (External Link)
Vendor Page Anti DDX55 pAb (ATL-HPA039962)