Anti DDX55 pAb (ATL-HPA039962)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039962-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: DDX55
Alternative Gene Name: KIAA1595
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029389: 89%, ENSRNOG00000001043: 90%
Entrez Gene ID: 57696
Uniprot ID: Q8NHQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FALLRMPKMPELRGKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIKNKAWSKQKAK |
Gene Sequence | FALLRMPKMPELRGKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIKNKAWSKQKAK |
Gene ID - Mouse | ENSMUSG00000029389 |
Gene ID - Rat | ENSRNOG00000001043 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti DDX55 pAb (ATL-HPA039962) | |
Datasheet | Anti DDX55 pAb (ATL-HPA039962) Datasheet (External Link) |
Vendor Page | Anti DDX55 pAb (ATL-HPA039962) at Atlas Antibodies |
Documents & Links for Anti DDX55 pAb (ATL-HPA039962) | |
Datasheet | Anti DDX55 pAb (ATL-HPA039962) Datasheet (External Link) |
Vendor Page | Anti DDX55 pAb (ATL-HPA039962) |