Anti DDX54 pAb (ATL-HPA028244)

Atlas Antibodies

SKU:
ATL-HPA028244-25
  • Immunohistochemical staining of human kidney shows moderate to strong nucleolar positivity in cells in tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 54
Gene Name: DDX54
Alternative Gene Name: APR-5, DP97, MGC2835
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029599: 91%, ENSRNOG00000001377: 91%
Entrez Gene ID: 79039
Uniprot ID: Q8TDD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VDTKLNEQLKTSFFLVREDTKAAVLLHLLHNVVRPQDQTVVFVATKHHAEYLTELLTTQRVSCAHIYSALDPTARKINLAKFTLGKCSTLIVTDLAARGLDIPLLDNVINYSFP
Gene Sequence VDTKLNEQLKTSFFLVREDTKAAVLLHLLHNVVRPQDQTVVFVATKHHAEYLTELLTTQRVSCAHIYSALDPTARKINLAKFTLGKCSTLIVTDLAARGLDIPLLDNVINYSFP
Gene ID - Mouse ENSMUSG00000029599
Gene ID - Rat ENSRNOG00000001377
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDX54 pAb (ATL-HPA028244)
Datasheet Anti DDX54 pAb (ATL-HPA028244) Datasheet (External Link)
Vendor Page Anti DDX54 pAb (ATL-HPA028244) at Atlas Antibodies

Documents & Links for Anti DDX54 pAb (ATL-HPA028244)
Datasheet Anti DDX54 pAb (ATL-HPA028244) Datasheet (External Link)
Vendor Page Anti DDX54 pAb (ATL-HPA028244)