Anti DDX50 pAb (ATL-HPA037389)

Atlas Antibodies

Catalog No.:
ATL-HPA037389-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 50
Gene Name: DDX50
Alternative Gene Name: GU2, GUB, MGC3199, RH-II/GuB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020076: 80%, ENSRNOG00000000396: 77%
Entrez Gene ID: 79009
Uniprot ID: Q9BQ39
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MKEKLNGDTEEGFNRLSDEFSKSHKSRRKDLPNGDIDEYEKKSKRVSSLDTSTHKSSDNKLEETLTREQKE
Gene Sequence MKEKLNGDTEEGFNRLSDEFSKSHKSRRKDLPNGDIDEYEKKSKRVSSLDTSTHKSSDNKLEETLTREQKE
Gene ID - Mouse ENSMUSG00000020076
Gene ID - Rat ENSRNOG00000000396
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DDX50 pAb (ATL-HPA037389)
Datasheet Anti DDX50 pAb (ATL-HPA037389) Datasheet (External Link)
Vendor Page Anti DDX50 pAb (ATL-HPA037389) at Atlas Antibodies

Documents & Links for Anti DDX50 pAb (ATL-HPA037389)
Datasheet Anti DDX50 pAb (ATL-HPA037389) Datasheet (External Link)
Vendor Page Anti DDX50 pAb (ATL-HPA037389)