Anti DDX50 pAb (ATL-HPA037389)

Atlas Antibodies

Catalog No.: ATL-HPA037389-25

Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 50
Gene Name: DDX50
Alternative Gene Name: GU2, GUB, MGC3199, RH-II/GuB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020076: 80%, ENSRNOG00000000396: 77%
Entrez Gene ID: 79009
Uniprot ID: Q9BQ39
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MKEKLNGDTEEGFNRLSDEFSKSHKSRRKDLPNGDIDEYEKKSKRVSSLDTSTHKSSDNKLEETLTREQKE
• Gene Sequence: MKEKLNGDTEEGFNRLSDEFSKSHKSRRKDLPNGDIDEYEKKSKRVSSLDTSTHKSSDNKLEETLTREQKE
• Gene ID - Mouse: ENSMUSG00000020076
• Gene ID - Rat: ENSRNOG00000000396
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.