Anti DDX50 pAb (ATL-HPA037388 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA037388-100
  • Immunohistochemical staining of human vulva/anal skin shows moderate nucleolar positivity in squamous epithelial cells.
  • Immunofluorescent staining of human cell line A-431 shows positivity in nucleoli.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and DDX50 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411421).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 50
Gene Name: DDX50
Alternative Gene Name: GU2, GUB, MGC3199, RH-II/GuB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020076: 93%, ENSRNOG00000000396: 95%
Entrez Gene ID: 79009
Uniprot ID: Q9BQ39
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSSNAVSQITRMCLLKGNMGVCFDVPTTESERLQAEWHDSDWILSVPAKLPEIEEYYDGNTSSNSRQRSGWSSG
Gene Sequence LSSNAVSQITRMCLLKGNMGVCFDVPTTESERLQAEWHDSDWILSVPAKLPEIEEYYDGNTSSNSRQRSGWSSG
Gene ID - Mouse ENSMUSG00000020076
Gene ID - Rat ENSRNOG00000000396
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDX50 pAb (ATL-HPA037388 w/enhanced validation)
Datasheet Anti DDX50 pAb (ATL-HPA037388 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DDX50 pAb (ATL-HPA037388 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DDX50 pAb (ATL-HPA037388 w/enhanced validation)
Datasheet Anti DDX50 pAb (ATL-HPA037388 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DDX50 pAb (ATL-HPA037388 w/enhanced validation)