Anti DDX5 pAb (ATL-HPA071154)

Atlas Antibodies

SKU:
ATL-HPA071154-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nucleoli.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: DEAD-box helicase 5
Gene Name: DDX5
Alternative Gene Name: G17P1, HLR1, p68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020719: 98%, ENSRNOG00000030680: 98%
Entrez Gene ID: 1655
Uniprot ID: P17844
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPM
Gene Sequence TQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPM
Gene ID - Mouse ENSMUSG00000020719
Gene ID - Rat ENSRNOG00000030680
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDX5 pAb (ATL-HPA071154)
Datasheet Anti DDX5 pAb (ATL-HPA071154) Datasheet (External Link)
Vendor Page Anti DDX5 pAb (ATL-HPA071154) at Atlas Antibodies

Documents & Links for Anti DDX5 pAb (ATL-HPA071154)
Datasheet Anti DDX5 pAb (ATL-HPA071154) Datasheet (External Link)
Vendor Page Anti DDX5 pAb (ATL-HPA071154)