Anti DDX5 pAb (ATL-HPA020043 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA020043-100

• 
• 
• 

Protein Description: DEAD (Asp-Glu-Ala-Asp) box helicase 5
Gene Name: DDX5
Alternative Gene Name: G17P1, HLR1, p68
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020719: 99%, ENSRNOG00000030680: 99%
Entrez Gene ID: 1655
Uniprot ID: P17844
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQV
• Gene Sequence: LDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQV
• Gene ID - Mouse: ENSMUSG00000020719
• Gene ID - Rat: ENSRNOG00000030680
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.