Anti DDX47 pAb (ATL-HPA014855)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014855-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: DDX47
Alternative Gene Name: DKFZp564O176, FLJ30012, HQ0256, RRP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030204: 94%, ENSRNOG00000007838: 94%
Entrez Gene ID: 51202
Uniprot ID: Q9H0S4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPGFPTQDDEVMMLTERVAEAQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR |
| Gene Sequence | IHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPGFPTQDDEVMMLTERVAEAQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR |
| Gene ID - Mouse | ENSMUSG00000030204 |
| Gene ID - Rat | ENSRNOG00000007838 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DDX47 pAb (ATL-HPA014855) | |
| Datasheet | Anti DDX47 pAb (ATL-HPA014855) Datasheet (External Link) |
| Vendor Page | Anti DDX47 pAb (ATL-HPA014855) at Atlas Antibodies |
| Documents & Links for Anti DDX47 pAb (ATL-HPA014855) | |
| Datasheet | Anti DDX47 pAb (ATL-HPA014855) Datasheet (External Link) |
| Vendor Page | Anti DDX47 pAb (ATL-HPA014855) |
| Citations for Anti DDX47 pAb (ATL-HPA014855) – 1 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |