Anti DDX47 pAb (ATL-HPA014855)

Atlas Antibodies

Catalog No.:
ATL-HPA014855-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 47
Gene Name: DDX47
Alternative Gene Name: DKFZp564O176, FLJ30012, HQ0256, RRP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030204: 94%, ENSRNOG00000007838: 94%
Entrez Gene ID: 51202
Uniprot ID: Q9H0S4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPGFPTQDDEVMMLTERVAEAQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR
Gene Sequence IHRVGRTARAGRSGKAITFVTQYDVELFQRIEHLIGKKLPGFPTQDDEVMMLTERVAEAQRFARMELREHGEKKKRSREDAGDNDDTEGAIGVRNKVAGGKMKKRKGR
Gene ID - Mouse ENSMUSG00000030204
Gene ID - Rat ENSRNOG00000007838
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DDX47 pAb (ATL-HPA014855)
Datasheet Anti DDX47 pAb (ATL-HPA014855) Datasheet (External Link)
Vendor Page Anti DDX47 pAb (ATL-HPA014855) at Atlas Antibodies

Documents & Links for Anti DDX47 pAb (ATL-HPA014855)
Datasheet Anti DDX47 pAb (ATL-HPA014855) Datasheet (External Link)
Vendor Page Anti DDX47 pAb (ATL-HPA014855)
Citations for Anti DDX47 pAb (ATL-HPA014855) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed