Anti DDX46 pAb (ATL-HPA036554 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA036554-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in seminiferous tubules.
  • Western blot analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-DDX46 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 46
Gene Name: DDX46
Alternative Gene Name: FLJ25329, KIAA0801, Prp5, PRPF5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021500: 95%, ENSRNOG00000021637: 96%
Entrez Gene ID: 9879
Uniprot ID: Q7L014
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen KEGNEMEGEELDPLDAYMEEVKEEVKKFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAM
Gene Sequence KEGNEMEGEELDPLDAYMEEVKEEVKKFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAM
Gene ID - Mouse ENSMUSG00000021500
Gene ID - Rat ENSRNOG00000021637
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDX46 pAb (ATL-HPA036554 w/enhanced validation)
Datasheet Anti DDX46 pAb (ATL-HPA036554 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DDX46 pAb (ATL-HPA036554 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DDX46 pAb (ATL-HPA036554 w/enhanced validation)
Datasheet Anti DDX46 pAb (ATL-HPA036554 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DDX46 pAb (ATL-HPA036554 w/enhanced validation)