Anti DDX43 pAb (ATL-HPA031381 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA031381-25

• 
• 

Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 43
Gene Name: DDX43
Alternative Gene Name: CT13, DKFZp434H2114, HAGE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070291: 65%, ENSRNOG00000050868: 65%
Entrez Gene ID: 55510
Uniprot ID: Q9NXZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GIDTAFQPSVGKDGSTDNNVVAGDRPLIDWDQIREEGLKWQKTKWADLPPIKKNFYKESTATSAMSKVEADSWR
• Gene Sequence: GIDTAFQPSVGKDGSTDNNVVAGDRPLIDWDQIREEGLKWQKTKWADLPPIKKNFYKESTATSAMSKVEADSWR
• Gene ID - Mouse: ENSMUSG00000070291
• Gene ID - Rat: ENSRNOG00000050868
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DDX43 pAb (ATL-HPA031381 w/enhanced validation) – 3 Found

Talwar, Tanu; Vidhyasagar, Venkatasubramanian; Qing, Jennifer; Guo, Manhong; Kariem, Ahmad; Lu, Yi; Singh, Ravi Shankar; Lukong, Kiven Erique; Wu, Yuliang. The DEAD-box protein DDX43 (HAGE) is a dual RNA-DNA helicase and has a K-homology domain required for full nucleic acid unwinding activity. The Journal Of Biological Chemistry. 2017;292(25):10429-10443. 

Almshayakhchi, Rukaia; Nagarajan, Divya; Vadakekolathu, Jayakumar; Guinn, Barbara-Ann; Reeder, Stephen; Brentville, Victoria; Metheringham, Rachael; Pockley, A Graham; Durrant, Lindy; McArdle, Stephanie. A Novel HAGE/WT1-ImmunoBody(®) Vaccine Combination Enhances Anti-Tumour Responses When Compared to Either Vaccine Alone. Frontiers In Oncology. 11( 34262856):636977. 

Abdel-Fatah, T M A; McArdle, S E B; Johnson, C; Moseley, P M; Ball, G R; Pockley, A G; Ellis, I O; Rees, R C; Chan, S Y T. HAGE (DDX43) is a biomarker for poor prognosis and a predictor of chemotherapy response in breast cancer. British Journal Of Cancer. 2014;110(10):2450-61.