Anti DDX42 pAb (ATL-HPA025941)

Atlas Antibodies

SKU:
ATL-HPA025941-100
  • Immunohistochemical staining of human Testis shows strong nuclear positivity in Leydig cells and cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box helicase 42
Gene Name: DDX42
Alternative Gene Name: RHELP, RNAHP, SF3b125, SF3B8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020705: 99%, ENSRNOG00000009474: 99%
Entrez Gene ID: 11325
Uniprot ID: Q86XP3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TAGVVQEEEEDNLEYDSDGNPIAPTKKIIDPLPPIDHSEIDYPPFEKNFYNEHEEITNLTPQQLIDLRHKLNLRVSGAAPPRPGSSFAHFGFDEQLMHQIRKSEYTQPTPIQCQG
Gene Sequence TAGVVQEEEEDNLEYDSDGNPIAPTKKIIDPLPPIDHSEIDYPPFEKNFYNEHEEITNLTPQQLIDLRHKLNLRVSGAAPPRPGSSFAHFGFDEQLMHQIRKSEYTQPTPIQCQG
Gene ID - Mouse ENSMUSG00000020705
Gene ID - Rat ENSRNOG00000009474
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDX42 pAb (ATL-HPA025941)
Datasheet Anti DDX42 pAb (ATL-HPA025941) Datasheet (External Link)
Vendor Page Anti DDX42 pAb (ATL-HPA025941) at Atlas Antibodies

Documents & Links for Anti DDX42 pAb (ATL-HPA025941)
Datasheet Anti DDX42 pAb (ATL-HPA025941) Datasheet (External Link)
Vendor Page Anti DDX42 pAb (ATL-HPA025941)