Anti DDX42 pAb (ATL-HPA023571)

Atlas Antibodies

SKU:
ATL-HPA023571-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
  • Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box helicase 42
Gene Name: DDX42
Alternative Gene Name: RHELP, RNAHP, SF3b125, SF3B8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020705: 98%, ENSRNOG00000009474: 97%
Entrez Gene ID: 11325
Uniprot ID: Q86XP3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen FGATSSSSGFGKSAPPQLPSFYKIGSKRANFDEENAYFEDEEEDSSNVDLPYIPAENSPTRQQFHSKPVDSDSDDDPLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDD
Gene Sequence FGATSSSSGFGKSAPPQLPSFYKIGSKRANFDEENAYFEDEEEDSSNVDLPYIPAENSPTRQQFHSKPVDSDSDDDPLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDD
Gene ID - Mouse ENSMUSG00000020705
Gene ID - Rat ENSRNOG00000009474
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDX42 pAb (ATL-HPA023571)
Datasheet Anti DDX42 pAb (ATL-HPA023571) Datasheet (External Link)
Vendor Page Anti DDX42 pAb (ATL-HPA023571) at Atlas Antibodies

Documents & Links for Anti DDX42 pAb (ATL-HPA023571)
Datasheet Anti DDX42 pAb (ATL-HPA023571) Datasheet (External Link)
Vendor Page Anti DDX42 pAb (ATL-HPA023571)



Citations for Anti DDX42 pAb (ATL-HPA023571) – 1 Found
Zhang, Sunyuan; Hinde, Elizabeth; Parkyn Schneider, Molly; Jans, David A; Bogoyevitch, Marie A. Nuclear bodies formed by polyQ-ataxin-1 protein are liquid RNA/protein droplets with tunable dynamics. Scientific Reports. 2020;10(1):1557.  PubMed