Anti DDX41 pAb (ATL-HPA017911)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017911-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: DDX41
Alternative Gene Name: ABS, MGC8828
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021494: 93%, ENSRNOG00000012771: 95%
Entrez Gene ID: 51428
Uniprot ID: Q9UJV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MEESEPERRRARTDEVPAGGSRSEAEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGAAEEEQQDSGSEPRGDEDDIPLGPQSNVSLLDQHQHL |
| Gene Sequence | MEESEPERRRARTDEVPAGGSRSEAEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGAAEEEQQDSGSEPRGDEDDIPLGPQSNVSLLDQHQHL |
| Gene ID - Mouse | ENSMUSG00000021494 |
| Gene ID - Rat | ENSRNOG00000012771 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti DDX41 pAb (ATL-HPA017911) | |
| Datasheet | Anti DDX41 pAb (ATL-HPA017911) Datasheet (External Link) |
| Vendor Page | Anti DDX41 pAb (ATL-HPA017911) at Atlas Antibodies |
| Documents & Links for Anti DDX41 pAb (ATL-HPA017911) | |
| Datasheet | Anti DDX41 pAb (ATL-HPA017911) Datasheet (External Link) |
| Vendor Page | Anti DDX41 pAb (ATL-HPA017911) |
| Citations for Anti DDX41 pAb (ATL-HPA017911) – 1 Found |
| Peters, Dominik; Radine, Claudia; Reese, Alina; Budach, Wilfried; Sohn, Dennis; Jänicke, Reiner U. The DEAD-box RNA helicase DDX41 is a novel repressor of p21(WAF1/CIP1) mRNA translation. The Journal Of Biological Chemistry. 2017;292(20):8331-8341. PubMed |