Anti DDX41 pAb (ATL-HPA017911)

Atlas Antibodies

Catalog No.:
ATL-HPA017911-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 41
Gene Name: DDX41
Alternative Gene Name: ABS, MGC8828
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021494: 93%, ENSRNOG00000012771: 95%
Entrez Gene ID: 51428
Uniprot ID: Q9UJV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen MEESEPERRRARTDEVPAGGSRSEAEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGAAEEEQQDSGSEPRGDEDDIPLGPQSNVSLLDQHQHL
Gene Sequence MEESEPERRRARTDEVPAGGSRSEAEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGAAEEEQQDSGSEPRGDEDDIPLGPQSNVSLLDQHQHL
Gene ID - Mouse ENSMUSG00000021494
Gene ID - Rat ENSRNOG00000012771
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DDX41 pAb (ATL-HPA017911)
Datasheet Anti DDX41 pAb (ATL-HPA017911) Datasheet (External Link)
Vendor Page Anti DDX41 pAb (ATL-HPA017911) at Atlas Antibodies

Documents & Links for Anti DDX41 pAb (ATL-HPA017911)
Datasheet Anti DDX41 pAb (ATL-HPA017911) Datasheet (External Link)
Vendor Page Anti DDX41 pAb (ATL-HPA017911)
Citations for Anti DDX41 pAb (ATL-HPA017911) – 1 Found
Peters, Dominik; Radine, Claudia; Reese, Alina; Budach, Wilfried; Sohn, Dennis; Jänicke, Reiner U. The DEAD-box RNA helicase DDX41 is a novel repressor of p21(WAF1/CIP1) mRNA translation. The Journal Of Biological Chemistry. 2017;292(20):8331-8341.  PubMed