Anti DDX39B pAb (ATL-HPA055334)

Atlas Antibodies

Catalog No.:
ATL-HPA055334-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B
Gene Name: DDX39B
Alternative Gene Name: BAT1, D6S81E, UAP56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005481: 100%, ENSRNOG00000000841: 100%
Entrez Gene ID: 7919
Uniprot ID: Q13838
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATL
Gene Sequence YVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATL
Gene ID - Mouse ENSMUSG00000005481
Gene ID - Rat ENSRNOG00000000841
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti DDX39B pAb (ATL-HPA055334)
Datasheet Anti DDX39B pAb (ATL-HPA055334) Datasheet (External Link)
Vendor Page Anti DDX39B pAb (ATL-HPA055334) at Atlas Antibodies

Documents & Links for Anti DDX39B pAb (ATL-HPA055334)
Datasheet Anti DDX39B pAb (ATL-HPA055334) Datasheet (External Link)
Vendor Page Anti DDX39B pAb (ATL-HPA055334)