Anti DDX28 pAb (ATL-HPA041911 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041911-25
  • Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and DDX28 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402673).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 28
Gene Name: DDX28
Alternative Gene Name: FLJ11282, MDDX28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045538: 86%, ENSRNOG00000019817: 82%
Entrez Gene ID: 55794
Uniprot ID: Q9NUL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLLDESFLELVDYILEKSHIAEGPADLEDPFNPKAQLVLVGATFPEGVGQLLNKVASPDAVTTITSSKLHCIMPHVKQTFLRLKGADK
Gene Sequence TLLDESFLELVDYILEKSHIAEGPADLEDPFNPKAQLVLVGATFPEGVGQLLNKVASPDAVTTITSSKLHCIMPHVKQTFLRLKGADK
Gene ID - Mouse ENSMUSG00000045538
Gene ID - Rat ENSRNOG00000019817
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti DDX28 pAb (ATL-HPA041911 w/enhanced validation)
Datasheet Anti DDX28 pAb (ATL-HPA041911 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DDX28 pAb (ATL-HPA041911 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti DDX28 pAb (ATL-HPA041911 w/enhanced validation)
Datasheet Anti DDX28 pAb (ATL-HPA041911 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti DDX28 pAb (ATL-HPA041911 w/enhanced validation)